PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2239s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 803aa    MW: 86439.3 Da    PI: 6.8773
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2239s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-095726091954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  SapurV1A.2239s0010.1.p 572 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 609
                             664459******************************88 PP

2BELL79.74e-26459511153
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslA 53 
                             +r e+q+kk+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt l 
  SapurV1A.2239s0010.1.p 459 DRIEHQRKKVKLLSMLDEVDQRYNHYCEQMQMVVNSFDLVMGFGAAVPYTLLG 511
                             589***********************************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-56381523IPR006563POX domain
PfamPF075261.3E-38386511IPR006563POX domain
PROSITE profilePS5007112.568550613IPR001356Homeobox domain
SMARTSM003891.2E-9553617IPR001356Homeobox domain
CDDcd000863.35E-13553614No hitNo description
SuperFamilySSF466893.51E-17555620IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-29556619IPR009057Homeodomain-like
PfamPF059204.1E-18570609IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MGIATPPFPP ILPHSKTHQQ IPPDINSNPS NHNSMSQDYH QGIFSFSNGG FERSSVSHQE  60
HNQQQQHQQQ QQHEIAQQIR RGKLRIQSDY EPPPPALVGI GEGAEEESSG LPVYETVGML  120
SEMFNFPPAP AAAVDLLEQH VQSNYRTQPR QQQSATTNDW YNRNNRQSMT VGGLGIGDSK  180
NHNNNNSNRD TLAQHQHQIA GFNANSAAAM QLFLMNPSQP RSPKSPSPSH NQTPHSASST  240
LHMLLPNPSS SLQGFSAVSG GGFGATSVIS PPQFTWVSDS SHEGGNTGAP LNNPSEIIGV  300
VEGQGLSLSL SSSLQHLEAA KAEELRMGSG GLLYYNQGAG GSSSAQYYKN SGGHQNHQVL  360
HLQGGEGQNH HQVQVGFGSS LGVVNVLRNS KYVKAAQELL EEFCSVGRGQ FKKSKFGTQN  420
TNPSSKNNPG GGGGGGGGGG GGGGSSSSTI DLPHMSAADR IEHQRKKVKL LSMLDEVDQR  480
YNHYCEQMQM VVNSFDLVMG FGAAVPYTLL GEKDGAGTSA ITKGETPRLK LLEQSLRQQR  540
AFHQMGMMEQ EAWRPQRGLP ERSVNILRAW LFEHFLHPYP SDADKHLLAR QTGLSRNQVS  600
NWFINARVRL WKPMVEEMYQ QESKEEEPPG PEDRERKPAT SSTNSGLAQT PTPTKTATGS  660
SAPAATTTST PSGKRSEINA NENDPSLLAI NRQCFSENQA KLSTTIIAPA NIASTTEMAP  720
QPHDGQSFHD FADDTCRHGS IVTADYGTTS GDANTGADHI GSTLIRFGTP AAGDVSLTLG  780
LRHAGNMPEK SPTFSVRDFG GC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-16559616158Homeobox protein Meis1
4xrs_A1e-16559616158Homeobox protein Meis1
3k2a_B1e-16559617563Homeobox protein Meis2
3k2a_A1e-16559617563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009913.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_011009914.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLB9H6970.0B9H697_POPTR; Uncharacterized protein
STRINGPOPTR_0005s13780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-126BEL1-like homeodomain 2